PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_66924.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 398aa    MW: 43295.1 Da    PI: 7.1022
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_66924.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.83.5e-52111391128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi+++d++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++
  MLOC_66924.2  11 VPPGFRFHPTEEELLNYYLRKKVASEEIDL-DVIRDIDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN 106
                   69****************************.9***************952444443456************************************** PP

           NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +g++ktLvfykgrap+g+k+dW+mheyrl
  MLOC_66924.2 107 -AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                   .8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-557179IPR003441NAC domain
PROSITE profilePS5100555.8411179IPR003441NAC domain
PfamPF023654.6E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASEEIDL DVIRDIDLNK LEPWDIQEKC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DLPTIVTDAA PTATMAVSAA TSSDSGQEDG WVVCRVFKKK  180
HHHKDAGAGS GKRGGGGRDD GGKTARSSSP LYSSDDALDQ ILHYMGRSCK QEHELSSPRP  240
RTAASRYLRP LETVLGGHGF MKLPPLESPS AAATARSSTT TPLAASGDGN VERELAHAED  300
MLHEPHRDSG ITDWAMMDRL VASHLNGQHD ASTDQLCFDG THAGSNDVVD DTAVNGVAFY  360
SAAATRLLGG AAAGSGDDDL WSFARSAASS ERLSRVSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-48818014166NO APICAL MERISTEM PROTEIN
1ut4_B8e-48818014166NO APICAL MERISTEM PROTEIN
1ut7_A8e-48818014166NO APICAL MERISTEM PROTEIN
1ut7_B8e-48818014166NO APICAL MERISTEM PROTEIN
4dul_A8e-48818014166NAC domain-containing protein 19
4dul_B8e-48818014166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2484490.0AK248449.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf176e18, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648974.11e-169PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-125NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM0Y9980.0M0Y998_HORVD; Uncharacterized protein
STRINGMLOC_66924.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-94NAC family protein